Lineage for d1r05b_ (1r05 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537476Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 537477Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 537478Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 537483Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 537484Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 537492Domain d1r05b_: 1r05 B: [96724]
    mutant

Details for d1r05b_

PDB Entry: 1r05 (more details)

PDB Description: solution structure of max b-hlh-lz

SCOP Domain Sequences for d1r05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r05b_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
lqqdiddlkrqnalleqqvralegsgc

SCOP Domain Coordinates for d1r05b_:

Click to download the PDB-style file with coordinates for d1r05b_.
(The format of our PDB-style files is described here.)

Timeline for d1r05b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r05a_