Lineage for d1r05a_ (1r05 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640601Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 640602Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 640603Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 640608Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 640609Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 640616Domain d1r05a_: 1r05 A: [96723]

Details for d1r05a_

PDB Entry: 1r05 (more details)

PDB Description: solution structure of max b-hlh-lz
PDB Compounds: (A:) max protein

SCOP Domain Sequences for d1r05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r05a_ a.38.1.1 (A:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
lqqdiddlkrqnalleqqvralegsgc

SCOP Domain Coordinates for d1r05a_:

Click to download the PDB-style file with coordinates for d1r05a_.
(The format of our PDB-style files is described here.)

Timeline for d1r05a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r05b_