Lineage for d1qzza1 (1qzz A:10-101)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 352023Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (4 proteins)
    unknown function
  6. 352024Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species)
    evolved a different function; binds SAM and SAH
  7. 352025Species Streptomyces purpurascens [TaxId:1924] [101036] (2 PDB entries)
  8. 352026Domain d1qzza1: 1qzz A:10-101 [96719]
    Other proteins in same PDB: d1qzza2
    complexed with act, sam

Details for d1qzza1

PDB Entry: 1qzz (more details), 2.1 Å

PDB Description: crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)

SCOP Domain Sequences for d1qzza1:

Sequence, based on SEQRES records: (download)

>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekqgrplrptrlgmlladg

Sequence, based on observed residues (ATOM records): (download)

>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekgrplrptrlgmlladg

SCOP Domain Coordinates for d1qzza1:

Click to download the PDB-style file with coordinates for d1qzza1.
(The format of our PDB-style files is described here.)

Timeline for d1qzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzza2