Lineage for d1qzya1 (1qzy A:375-448)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762407Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 762408Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 762417Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
    Uniprot P50579 110-478
  8. 762419Domain d1qzya1: 1qzy A:375-448 [96717]
    Other proteins in same PDB: d1qzya2
    complexed with co, tbu, tde

Details for d1qzya1

PDB Entry: 1qzy (more details), 1.6 Å

PDB Description: Human Methionine Aminopeptidase in complex with bengamide inhibitor LAF153 and cobalt
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOP Domain Sequences for d1qzya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzya1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOP Domain Coordinates for d1qzya1:

Click to download the PDB-style file with coordinates for d1qzya1.
(The format of our PDB-style files is described here.)

Timeline for d1qzya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzya2