Lineage for d1qzxa3 (1qzx A:88-294)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394266Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 394367Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 394371Species Archaeon Sulfolobus solfataricus [TaxId:2287] [102373] (2 PDB entries)
  8. 394372Domain d1qzxa3: 1qzx A:88-294 [96713]
    Other proteins in same PDB: d1qzxa1, d1qzxa2, d1qzxb1, d1qzxb2

Details for d1qzxa3

PDB Entry: 1qzx (more details), 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzxa3 c.37.1.10 (A:88-294) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsrilgm

SCOP Domain Coordinates for d1qzxa3:

Click to download the PDB-style file with coordinates for d1qzxa3.
(The format of our PDB-style files is described here.)

Timeline for d1qzxa3: