![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal sequence recognition protein Ffh [47366] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [101121] (3 PDB entries) |
![]() | Domain d1qzxa1: 1qzx A:1-87 [96711] Other proteins in same PDB: d1qzxa2, d1qzxa3, d1qzxb2, d1qzxb3 |
PDB Entry: 1qzx (more details), 4 Å
SCOPe Domain Sequences for d1qzxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzxa1 a.24.13.1 (A:1-87) Signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]} mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp psvlerkewfisivydelsklfggdke
Timeline for d1qzxa1: