SCOPe 2.06: Domain d1qzwg2: 1qzw G:295-432

Lineage for d1qzwg2 (1qzw G:295-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)

8. Domain d1qzwg2: 1qzw G:295-432 [96709]
   Other proteins in same PDB: d1qzwa1, d1qzwa3, d1qzwc1, d1qzwc3, d1qzwe1, d1qzwe3, d1qzwg1, d1qzwg3
   protein/RNA complex

Details for d1qzwg2

PDB Entry: 1qzw, 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

PDB Compounds: (G:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzwg2:

Sequence; same for both SEQRES and ATOM records:

>d1qzwg2 a.36.1.1 (G:295-432) Signal sequence binding protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

Timeline for d1qzwg2:

• d1qzwg2 first appeared in SCOP 1.67
  
• d1qzwg2 appears in SCOPe 2.05
  
• d1qzwg2 appears in SCOPe 2.07
  
• d1qzwg2 appears in the current release, SCOPe 2.08