SCOP 1.67: Domain d1qzwg1: 1qzw G:1-87

Lineage for d1qzwg1 (1qzw G:1-87)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101121] (2 PDB entries)

8. Domain d1qzwg1: 1qzw G:1-87 [96708]
   Other proteins in same PDB: d1qzwa2, d1qzwa3, d1qzwc2, d1qzwc3, d1qzwe2, d1qzwe3, d1qzwg2, d1qzwg3
   complexed with ccc, gtp

Details for d1qzwg1

PDB Entry: 1qzw, 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzwg1:

Sequence; same for both SEQRES and ATOM records:

>d1qzwg1 a.24.13.1 (G:1-87) Signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus}
mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
psvlerkewfisivydelsklfggdke

Timeline for d1qzwg1:

• d1qzwg1 is new in SCOP 1.67
  
• d1qzwg1 appears in SCOP 1.69
  
• d1qzwg1 appears in the current release, SCOPe 2.08