Lineage for d1qzwa3 (1qzw A:88-294)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477146Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2477285Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2477289Species Sulfolobus solfataricus [TaxId:2287] [102373] (3 PDB entries)
  8. 2477292Domain d1qzwa3: 1qzw A:88-294 [96701]
    Other proteins in same PDB: d1qzwa1, d1qzwa2, d1qzwc1, d1qzwc2, d1qzwe1, d1qzwe2, d1qzwg1, d1qzwg2
    protein/RNA complex

Details for d1qzwa3

PDB Entry: 1qzw (more details), 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (A:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzwa3 c.37.1.10 (A:88-294) GTPase domain of the signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsrilgm

SCOPe Domain Coordinates for d1qzwa3:

Click to download the PDB-style file with coordinates for d1qzwa3.
(The format of our PDB-style files is described here.)

Timeline for d1qzwa3: