Lineage for d1qzwa1 (1qzw A:1-87)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988970Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 1988971Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 1988986Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 1988990Species Sulfolobus solfataricus [TaxId:2287] [101121] (2 PDB entries)
  8. 1988993Domain d1qzwa1: 1qzw A:1-87 [96699]
    Other proteins in same PDB: d1qzwa2, d1qzwa3, d1qzwc2, d1qzwc3, d1qzwe2, d1qzwe3, d1qzwg2, d1qzwg3
    protein/RNA complex

Details for d1qzwa1

PDB Entry: 1qzw (more details), 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (A:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzwa1 a.24.13.1 (A:1-87) Signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
psvlerkewfisivydelsklfggdke

SCOPe Domain Coordinates for d1qzwa1:

Click to download the PDB-style file with coordinates for d1qzwa1.
(The format of our PDB-style files is described here.)

Timeline for d1qzwa1: