SCOPe 2.08: Domain d1qzvf_: 1qzv F:

Lineage for d1qzvf_ (1qzv F:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.5: Photosystems [58155] (1 superfamily)

4. Superfamily i.5.1: Photosystems [58156] (1 family)

5. Family i.5.1.1: Photosystems [58157] (5 proteins)
   not a true family

6. Protein Plant photosystem I [103667] (1 species)
7. Species Pea (Pisum sativum) [TaxId:3888] [103668] (1 PDB entry)

8. Domain d1qzvf_: 1qzv F: [96682]
   complexed with cla, pqn, sf4

Details for d1qzvf_

PDB Entry: 1qzv, 4.44 Å

PDB Description: Crystal structure of plant photosystem I

PDB Compounds: (F:) plant photosystem I: subunit psaf

SCOPe Domain Sequences for d1qzvf_:

Sequence; same for both SEQRES and ATOM records:

>d1qzvf_ i.5.1.1 (F:) Plant photosystem I {Pea (Pisum sativum) [TaxId: 3888]}
xxxxxxxxxxxxxxxxxekqalkklqaslklyaddsapalaikatmexxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Timeline for d1qzvf_:

• d1qzvf_ first appeared in SCOP 1.67
  
• d1qzvf_ appears in SCOPe 2.07