Lineage for d1qzud_ (1qzu D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108181Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108182Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2108183Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 protein domains)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 2108184Protein 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) [52509] (2 species)
    involved in signal transduction; binds FMN
  7. 2108185Species Human (Homo sapiens) [TaxId:9606] [102300] (1 PDB entry)
    hypothetical protein mds018
  8. 2108189Domain d1qzud_: 1qzu D: [96666]
    complexed with fmn

Details for d1qzud_

PDB Entry: 1qzu (more details), 2.91 Å

PDB Description: crystal structure of human phosphopantothenoylcysteine decarboxylase
PDB Compounds: (D:) hypothetical protein MDS018

SCOPe Domain Sequences for d1qzud_:

Sequence, based on SEQRES records: (download)

>d1qzud_ c.34.1.1 (D:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]}
rkfhvlvgvtgsvaalklpllvsklldipglevavvtterakhfyspqdipvtlysdade
wemwksrsdpvlhidlrrwadlllvapldantlgkvasgicdnlltcvmrawdrskpllf
cpamntamwehpitaqqvdqlkafgyveipcvakklvcgdeglgamaevgtivdkv

Sequence, based on observed residues (ATOM records): (download)

>d1qzud_ c.34.1.1 (D:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]}
rkfhvlvgvtgsvaalklpllvskllglevavvtterakhfyspqdipvtlysdadewem
wksrsdpvlhidlrrwadlllvapldantlgkvasgicdnlltcvmrawdrskpllfcpa
mntamwehpitaqqvdqlkafgyveipvgtivdkv

SCOPe Domain Coordinates for d1qzud_:

Click to download the PDB-style file with coordinates for d1qzud_.
(The format of our PDB-style files is described here.)

Timeline for d1qzud_: