Lineage for d1qzra2 (1qzr A:7-245)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417809Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 417810Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 417834Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 417861Protein DNA topoisomerase II [103226] (1 species)
  7. 417862Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (2 PDB entries)
  8. 417865Domain d1qzra2: 1qzr A:7-245 [96660]
    Other proteins in same PDB: d1qzra1, d1qzrb1

Details for d1qzra2

PDB Entry: 1qzr (more details), 1.9 Å

PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii bound to icrf-187 (dexrazoxane)

SCOP Domain Sequences for d1qzra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzra2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae)}
sasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifde
ilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllt
ssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkit
sykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir

SCOP Domain Coordinates for d1qzra2:

Click to download the PDB-style file with coordinates for d1qzra2.
(The format of our PDB-style files is described here.)

Timeline for d1qzra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzra1