Lineage for d1qzqa1 (1qzq A:161-350)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418737Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 418738Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families) (S)
  5. 418749Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (1 protein)
  6. 418750Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (1 species)
  7. 418751Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries)
  8. 418786Domain d1qzqa1: 1qzq A:161-350 [96655]

Details for d1qzqa1

PDB Entry: 1qzq (more details), 2.4 Å

PDB Description: human tyrosyl dna phosphodiesterase

SCOP Domain Sequences for d1qzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzqa1 d.136.1.3 (A:161-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens)}
gnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefr
kkpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvvih
tsnlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewid
vihkhdlset

SCOP Domain Coordinates for d1qzqa1:

Click to download the PDB-style file with coordinates for d1qzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1qzqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzqa2