Lineage for d1qzpa_ (1qzp A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082331Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1082332Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 1082333Family a.14.1.1: VHP, Villin headpiece domain [47051] (4 proteins)
  6. 1082340Protein Dematin [101099] (1 species)
  7. 1082341Species Human (Homo sapiens) [TaxId:9606] [101100] (1 PDB entry)
  8. 1082342Domain d1qzpa_: 1qzp A: [96654]

Details for d1qzpa_

PDB Entry: 1qzp (more details)

PDB Description: nmr structure of the human dematin headpiece domain
PDB Compounds: (A:) dematin

SCOPe Domain Sequences for d1qzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzpa_ a.14.1.1 (A:) Dematin {Human (Homo sapiens) [TaxId: 9606]}
pglqiypyemlvvtnkgrtklppgvdrmrlerhlsaedfsrvfamspeefgklalwkrne
lkkkaslf

SCOPe Domain Coordinates for d1qzpa_:

Click to download the PDB-style file with coordinates for d1qzpa_.
(The format of our PDB-style files is described here.)

Timeline for d1qzpa_: