SCOP 1.69: Domain d1qzoa2: 1qzo A:240-307

Lineage for d1qzoa2 (1qzo A:240-307)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (4 species)
   secreted during involution

7. Species Goat (Capra hircus) [TaxId:9925] [89883] (3 PDB entries)

8. Domain d1qzoa2: 1qzo A:240-307 [96653]
   Other proteins in same PDB: d1qzoa1

Details for d1qzoa2

PDB Entry: 1qzo, 2.35 Å

PDB Description: Three dimensional structure of a goat signalling protein secreted during involution

SCOP Domain Sequences for d1qzoa2:

Sequence; same for both SEQRES and ATOM records:

>d1qzoa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus)}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1qzoa2:

• d1qzoa2 first appeared in SCOP 1.67
  
• d1qzoa2 appears in SCOP 1.71
  
• d1qzoa2 last appears in SCOP 1.73