Lineage for d1qzoa1 (1qzo A:1-239,A:308-361)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries) 
Domain d1qzoa1: 1qzo A:1-239,A:308-361 [96652]
Other proteins in same PDB: d1qzoa2
complexed with man, nag
Details for d1qzoa1
PDB Entry: 1qzo (more details), 2.35 Å
PDB Description: Three dimensional structure of a goat signalling protein secreted during involution
PDB Compounds: (A:) bp40SCOP Domain Sequences for d1qzoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzoa1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
SCOP Domain Coordinates for d1qzoa1:
Click to download the PDB-style file with coordinates for d1qzoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qzoa1:
- d1qzoa1 first appeared in SCOP 1.67
- d1qzoa1 appears in SCOP 1.71
- d1qzoa1 does not appear in SCOP 1.75
View in 3D
