Lineage for d1qzoa1 (1qzo A:1-239,A:308-361)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385302Protein Mammary gland protein (MGP-40) [89480] (1 species)
    secreted during involution
  7. 385303Species Goat (Capra hircus) [TaxId:9925] [89481] (4 PDB entries)
  8. 385304Domain d1qzoa1: 1qzo A:1-239,A:308-361 [96652]
    Other proteins in same PDB: d1qzoa2
    complexed with man, nag

Details for d1qzoa1

PDB Entry: 1qzo (more details), 2.35 Å

PDB Description: Three dimensional structure of a goat signalling protein secreted during involution

SCOP Domain Sequences for d1qzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzoa1 c.1.8.5 (A:1-239,A:308-361) Mammary gland protein (MGP-40) {Goat (Capra hircus)}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae

SCOP Domain Coordinates for d1qzoa1:

Click to download the PDB-style file with coordinates for d1qzoa1.
(The format of our PDB-style files is described here.)

Timeline for d1qzoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qzoa2