Lineage for d1qzhf_ (1qzh F:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374604Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 374643Protein Protection of telomeres protein 1, Pot1 [101761] (1 species)
  7. 374644Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries)
  8. 374652Domain d1qzhf_: 1qzh F: [96650]

Details for d1qzhf_

PDB Entry: 1qzh (more details), 2.4 Å

PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex

SCOP Domain Sequences for d1qzhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzhf_ b.40.4.3 (F:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe)}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn

SCOP Domain Coordinates for d1qzhf_:

Click to download the PDB-style file with coordinates for d1qzhf_.
(The format of our PDB-style files is described here.)

Timeline for d1qzhf_: