Lineage for d1qzhe_ (1qzh E:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
barrel, closed; n=5, S=10
Protein Protection of telomeres protein 1, Pot1 [101761] (1 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries) 
Domain d1qzhe_: 1qzh E: [96649]
Details for d1qzhe_
PDB Entry: 1qzh (more details), 2.4 Å
PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
SCOP Domain Sequences for d1qzhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzhe_ b.40.4.3 (E:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe)}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
SCOP Domain Coordinates for d1qzhe_:
Click to download the PDB-style file with coordinates for d1qzhe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qzhe_:
- d1qzhe_ first appeared in SCOP 1.67
- d1qzhe_ appears in SCOP 1.71
- d1qzhe_ appears in the current release, SCOPe 2.08
View in 3D
