Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein Protection of telomeres protein 1, Pot1 [101761] (2 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries) |
Domain d1qzhd_: 1qzh D: [96648] protein/DNA complex |
PDB Entry: 1qzh (more details), 2.4 Å
SCOPe Domain Sequences for d1qzhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzhd_ b.40.4.3 (D:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
Timeline for d1qzhd_: