Lineage for d1qzhb_ (1qzh B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799525Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)
  7. 799526Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries)
  8. 799530Domain d1qzhb_: 1qzh B: [96646]

Details for d1qzhb_

PDB Entry: 1qzh (more details), 2.4 Å

PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
PDB Compounds: (B:) Protection of telomeres protein 1

SCOP Domain Sequences for d1qzhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzhb_ b.40.4.3 (B:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn

SCOP Domain Coordinates for d1qzhb_:

Click to download the PDB-style file with coordinates for d1qzhb_.
(The format of our PDB-style files is described here.)

Timeline for d1qzhb_: