Lineage for d1qzha_ (1qzh A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
barrel, closed; n=5, S=10
Protein Protection of telomeres protein 1, Pot1 [101761] (1 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries) 
Domain d1qzha_: 1qzh A: [96645]
Details for d1qzha_
PDB Entry: 1qzh (more details), 2.4 Å
PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
SCOP Domain Sequences for d1qzha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzha_ b.40.4.3 (A:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe)}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
SCOP Domain Coordinates for d1qzha_:
Click to download the PDB-style file with coordinates for d1qzha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qzha_:
- d1qzha_ first appeared in SCOP 1.67
- d1qzha_ appears in SCOP 1.71
- d1qzha_ appears in the current release, SCOPe 2.08
View in 3D
