SCOPe 2.06: Domain d1qzga_: 1qzg A:

Lineage for d1qzga_ (1qzg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries)

8. Domain d1qzga_: 1qzg A: [96643]
   protein/DNA complex; complexed with tmp

Details for d1qzga_

PDB Entry: 1qzg, 1.9 Å

PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex

PDB Compounds: (A:) Protection of telomeres protein 1

SCOPe Domain Sequences for d1qzga_:

Sequence; same for both SEQRES and ATOM records:

>d1qzga_ b.40.4.3 (A:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn

Timeline for d1qzga_:

• d1qzga_ first appeared in SCOP 1.67
  
• d1qzga_ appears in SCOPe 2.05
  
• d1qzga_ appears in SCOPe 2.07
  
• d1qzga_ appears in the current release, SCOPe 2.08