![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Protection of telomeres protein 1, Pot1 [101761] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries) |
![]() | Domain d1qzga_: 1qzg A: [96643] |
PDB Entry: 1qzg (more details), 1.9 Å
SCOP Domain Sequences for d1qzga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzga_ b.40.4.3 (A:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe)} vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
Timeline for d1qzga_: