Lineage for d1qzfe1 (1qzf E:3-180)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843144Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 843145Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 843146Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 843156Domain d1qzfe1: 1qzf E:3-180 [96641]
    Other proteins in same PDB: d1qzfa2, d1qzfb2, d1qzfc2, d1qzfd2, d1qzfe2
    complexed with cb3, fol, ndp, ump

Details for d1qzfe1

PDB Entry: 1qzf (more details), 2.8 Å

PDB Description: Crystal structure of DHFR-TS from Cryptosporidium hominis
PDB Compounds: (E:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOP Domain Sequences for d1qzfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzfe1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOP Domain Coordinates for d1qzfe1:

Click to download the PDB-style file with coordinates for d1qzfe1.
(The format of our PDB-style files is described here.)

Timeline for d1qzfe1: