Lineage for d1qzfe1 (1qzf E:3-180)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401379Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 401380Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 401381Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 401382Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 401383Species Cryptosporidium hominis [TaxId:237895] [102636] (1 PDB entry)
  8. 401388Domain d1qzfe1: 1qzf E:3-180 [96641]
    Other proteins in same PDB: d1qzfa2, d1qzfb2, d1qzfc2, d1qzfd2, d1qzfe2
    complexed with cb3, fol, ndp, ump

Details for d1qzfe1

PDB Entry: 1qzf (more details), 2.8 Å

PDB Description: Crystal structure of DHFR-TS from Cryptosporidium hominis

SCOP Domain Sequences for d1qzfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzfe1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOP Domain Coordinates for d1qzfe1:

Click to download the PDB-style file with coordinates for d1qzfe1.
(The format of our PDB-style files is described here.)

Timeline for d1qzfe1: