Lineage for d1qzea4 (1qze A:1-77)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499571Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 499572Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 499576Domain d1qzea4: 1qze A:1-77 [96632]
    Other proteins in same PDB: d1qzea1, d1qzea2, d1qzea3

Details for d1qzea4

PDB Entry: 1qze (more details)

PDB Description: hhr23a protein structure based on residual dipolar coupling data

SCOP Domain Sequences for d1qzea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzea4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens)}
savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvt

SCOP Domain Coordinates for d1qzea4:

Click to download the PDB-style file with coordinates for d1qzea4.
(The format of our PDB-style files is described here.)

Timeline for d1qzea4: