Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (14 proteins) |
Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries) |
Domain d1qzea4: 1qze A:1-77 [96632] Other proteins in same PDB: d1qzea1, d1qzea2, d1qzea3 |
PDB Entry: 1qze (more details)
SCOP Domain Sequences for d1qzea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzea4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens)} savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp irdyrideknfvvvmvt
Timeline for d1qzea4: