Lineage for d1qzea4 (1qze A:2-77)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158896Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 2158897Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 2158899Domain d1qzea4: 1qze A:2-77 [96632]
    Other proteins in same PDB: d1qzea1, d1qzea2, d1qzea3, d1qzea5

Details for d1qzea4

PDB Entry: 1qze (more details)

PDB Description: HHR23a protein structure based on residual dipolar coupling data
PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1qzea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzea4 d.15.1.1 (A:2-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
avtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvpi
rdyrideknfvvvmvt

SCOPe Domain Coordinates for d1qzea4:

Click to download the PDB-style file with coordinates for d1qzea4.
(The format of our PDB-style files is described here.)

Timeline for d1qzea4: