Lineage for d1qzea3 (1qze A:232-283)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752940Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 1752941Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 1752942Family a.189.1.1: XPC-binding domain [101239] (4 proteins)
  6. 1752946Protein XPC-binding domain of Rad23 homolog A (Hhr23a) [101240] (1 species)
  7. 1752947Species Human (Homo sapiens) [TaxId:9606] [101241] (3 PDB entries)
    Uniprot P54725 230-288
  8. 1752948Domain d1qzea3: 1qze A:232-283 [96631]
    Other proteins in same PDB: d1qzea1, d1qzea2, d1qzea4

Details for d1qzea3

PDB Entry: 1qze (more details)

PDB Description: hhr23a protein structure based on residual dipolar coupling data
PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1qzea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzea3 a.189.1.1 (A:232-283) XPC-binding domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
leflrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqm

SCOPe Domain Coordinates for d1qzea3:

Click to download the PDB-style file with coordinates for d1qzea3.
(The format of our PDB-style files is described here.)

Timeline for d1qzea3: