Lineage for d1qzea2 (1qze A:317-360)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985379Protein DNA repair protein Hhr23a [46936] (1 species)
  7. 1985380Species Human (Homo sapiens) [TaxId:9606] [46937] (6 PDB entries)
  8. 1985383Domain d1qzea2: 1qze A:317-360 [96630]
    Other proteins in same PDB: d1qzea3, d1qzea4, d1qzea5

Details for d1qzea2

PDB Entry: 1qze (more details)

PDB Description: hhr23a protein structure based on residual dipolar coupling data
PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1qzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzea2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}
tpqekeaierlkalgfpeslviqayfaceknenlaanfllsqnf

SCOPe Domain Coordinates for d1qzea2:

Click to download the PDB-style file with coordinates for d1qzea2.
(The format of our PDB-style files is described here.)

Timeline for d1qzea2: