Lineage for d1qzcl_ (1qzc L:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627102Domain d1qzcl_: 1qzc L: [96627]
    S12, sh44, lh69 and srl separately fitted into the cryo-EM map of EF-Tu ternary complex

Details for d1qzcl_

PDB Entry: 1qzc (more details), 9 Å

PDB Description: coordinates of s12, sh44, lh69 and srl separately fitted into the cryo-em map of ef-tu ternary complex (gdp.kirromycin) bound 70s ribosome

SCOP Domain Sequences for d1qzcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzcl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1qzcl_:

Click to download the PDB-style file with coordinates for d1qzcl_.
(The format of our PDB-style files is described here.)

Timeline for d1qzcl_: