Lineage for d1qzcl_ (1qzc L:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042956Domain d1qzcl_: 1qzc L: [96627]
    S12, sh44, lh69 and srl separately fitted into the cryo-EM map of EF-Tu ternary complex
    protein/RNA complex

Details for d1qzcl_

PDB Entry: 1qzc (more details)

PDB Description: coordinates of s12, sh44, lh69 and srl separately fitted into the cryo-em map of ef-tu ternary complex (gdp.kirromycin) bound 70s ribosome
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1qzcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzcl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d1qzcl_:

Click to download the PDB-style file with coordinates for d1qzcl_.
(The format of our PDB-style files is described here.)

Timeline for d1qzcl_: