Lineage for d1qz9a_ (1qz9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131565Protein Kynureninase [102601] (1 species)
  7. 2131566Species Pseudomonas fluorescens [TaxId:294] [102602] (1 PDB entry)
  8. 2131567Domain d1qz9a_: 1qz9 A: [96621]
    complexed with cl, p3g, plp

Details for d1qz9a_

PDB Entry: 1qz9 (more details), 1.85 Å

PDB Description: The Three Dimensional Structure of Kynureninase from Pseudomonas fluorescens
PDB Compounds: (A:) kynureninase

SCOPe Domain Sequences for d1qz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]}
ttrndclaldaqdslaplrqqfalpegviyldgnslgarpvaalaraqaviaeewgngli
rswnsagwrdlserlgnrlatligardgevvvtdttsinlfkvlsaalrvqatrsperrv
ivtetsnfptdlyiaegladmlqqgytlrlvdspeelpqaidqdtavvmlthvnyktgym
hdmqaltalshecgalaiwdlahsagavpvdlhqagadyaigctykylnggpgsqafvwv
spqlcdlvpqplsgwfghsrqfamepryepsngiarylcgtqpitslamvecgldvfaqt
dmaslrrkslaltdlfielveqrcaaheltlvtprehakrgshvsfehpegyaviqalid
rgvigdyreprimrfgftplyttftevwdavqilgeildrktwa

SCOPe Domain Coordinates for d1qz9a_:

Click to download the PDB-style file with coordinates for d1qz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz9a_: