SCOP 1.67: Domain d1qz8b_: 1qz8 B:

Lineage for d1qz8b_ (1qz8 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (1 family)

5. Family b.140.1.1: Replicase NSP9 [101817] (1 protein)

6. Protein Replicase NSP9 [101818] (1 species)
   part of polyprotein 1AB; binds ssRNA

7. Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries)

8. Domain d1qz8b_: 1qz8 B: [96620]
   complexed with so4

Details for d1qz8b_

PDB Entry: 1qz8, 2.7 Å

PDB Description: Crystal structure of SARS coronavirus NSP9

SCOP Domain Sequences for d1qz8b_:

Sequence; same for both SEQRES and ATOM records:

>d1qz8b_ b.140.1.1 (B:) Replicase NSP9 {SARS coronavirus}
lspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdlkwarfpksdgtg
tiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

Timeline for d1qz8b_:

• d1qz8b_ is new in SCOP 1.67
  
• d1qz8b_ appears in SCOP 1.69
  
• d1qz8b_ appears in the current release, SCOPe 2.08