Lineage for d1qz8a_ (1qz8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412304Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2412305Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2412306Family b.140.1.1: Replicase NSP9 [101817] (2 protein domains)
    automatically mapped to Pfam PF08710
  6. 2412307Protein Replicase NSP9 [101818] (1 species)
    part of polyprotein 1AB; binds ssRNA
  7. 2412308Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries)
  8. 2412309Domain d1qz8a_: 1qz8 A: [96619]
    complexed with so4

Details for d1qz8a_

PDB Entry: 1qz8 (more details), 2.7 Å

PDB Description: Crystal structure of SARS coronavirus NSP9
PDB Compounds: (A:) polyprotein 1ab

SCOPe Domain Sequences for d1qz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz8a_ b.140.1.1 (A:) Replicase NSP9 {SARS coronavirus [TaxId: 227859]}
elspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdlkwarfpksdgt
gtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

SCOPe Domain Coordinates for d1qz8a_:

Click to download the PDB-style file with coordinates for d1qz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz8a_: