Lineage for d1qz7a_ (1qz7 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646822Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 646823Protein beta-Catenin [48373] (2 species)
  7. 646824Species Human (Homo sapiens) [TaxId:9606] [48375] (9 PDB entries)
  8. 646830Domain d1qz7a_: 1qz7 A: [96618]
    complex with beta-catenin binding domain of axin, chain B

Details for d1qz7a_

PDB Entry: 1qz7 (more details), 2.2 Å

PDB Description: Beta-catenin binding domain of Axin in complex with beta-catenin
PDB Compounds: (A:) beta-catenin

SCOP Domain Sequences for d1qz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz7a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
yqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrt
mqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhn
lllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggp
qalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnc
lwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqv
ggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpp
shwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfv
egvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcel
aqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsed

SCOP Domain Coordinates for d1qz7a_:

Click to download the PDB-style file with coordinates for d1qz7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz7a_: