Lineage for d1qz4a_ (1qz4 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450458Fold a.198: YcfC-like [101321] (1 superfamily)
    multihelical; contains two buried central helices
  4. 450459Superfamily a.198.1: YcfC-like [101322] (1 family) (S)
  5. 450460Family a.198.1.1: YcfC-like [101323] (1 protein)
    pfam 04356: protein of unknown function (DUF489)
  6. 450461Protein Hypothetical protein YcfC [101324] (1 species)
  7. 450462Species Escherichia coli [TaxId:562] [101325] (2 PDB entries)
  8. 450464Domain d1qz4a_: 1qz4 A: [96613]
    structural genomics

Details for d1qz4a_

PDB Entry: 1qz4 (more details), 2 Å

PDB Description: Structure of YcfC Protein of Unknown Function Escherichia coli

SCOP Domain Sequences for d1qz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz4a_ a.198.1.1 (A:) Hypothetical protein YcfC {Escherichia coli}
gaknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsea
nlrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrql
ehfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavl
whqvgggrlqlmfsrnrlttqakqilahltpel

SCOP Domain Coordinates for d1qz4a_:

Click to download the PDB-style file with coordinates for d1qz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz4a_: