Lineage for d1qz1a2 (1qz1 A:98-189)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2355074Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
  7. 2355077Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
    Rat and mouse sequences are identical for the two N-terminal modules
  8. 2355087Domain d1qz1a2: 1qz1 A:98-189 [96610]
    Other proteins in same PDB: d1qz1a4
    modules 1, 2 and 3

Details for d1qz1a2

PDB Entry: 1qz1 (more details), 2 Å

PDB Description: crystal structure of the ig 1-2-3 fragment of ncam
PDB Compounds: (A:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOPe Domain Sequences for d1qz1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz1a2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
rgikktdegtyrcegrilargeinfkdiqviv

SCOPe Domain Coordinates for d1qz1a2:

Click to download the PDB-style file with coordinates for d1qz1a2.
(The format of our PDB-style files is described here.)

Timeline for d1qz1a2: