Lineage for d1qz1a1 (1qz1 A:-1-97)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366356Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 366568Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
  7. 366571Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
    Rat and mouse sequences are identical for the two N-terminal modules
  8. 366580Domain d1qz1a1: 1qz1 A:-1-97 [96609]

Details for d1qz1a1

PDB Entry: 1qz1 (more details), 2 Å

PDB Description: crystal structure of the ig 1-2-3 fragment of ncam

SCOP Domain Sequences for d1qz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz1a1 b.1.1.4 (A:-1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
vlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddds
stltiynaniddagiykcvvtaedgtqseatvnvkifq

SCOP Domain Coordinates for d1qz1a1:

Click to download the PDB-style file with coordinates for d1qz1a1.
(The format of our PDB-style files is described here.)

Timeline for d1qz1a1: