Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Neural cell adhesion molecule (NCAM) [49166] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries) Rat and mouse sequences are identical for the two N-terminal modules |
Domain d1qz1a1: 1qz1 A:-1-97 [96609] |
PDB Entry: 1qz1 (more details), 2 Å
SCOP Domain Sequences for d1qz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qz1a1 b.1.1.4 (A:-1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)} vlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddds stltiynaniddagiykcvvtaedgtqseatvnvkifq
Timeline for d1qz1a1: