SCOPe 2.03: Domain d1qz0b_: 1qz0 B:

Lineage for d1qz0b_ (1qz0 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (15 PDB entries)

8. Domain d1qz0b_: 1qz0 B: [96608]
   complexed with a phosphotyrosyl mimetic-containing hexapeptide, chains C, D, E and F

Details for d1qz0b_

PDB Entry: 1qz0, 1.5 Å

PDB Description: crystal structure of the yersinia pestis phosphatase yoph in complex with a phosphotyrosyl mimetic-containing hexapeptide

PDB Compounds: (B:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d1qz0b_:

Sequence; same for both SEQRES and ATOM records:

>d1qz0b_ c.45.1.2 (B:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d1qz0b_:

• d1qz0b_ first appeared in SCOP 1.67
  
• d1qz0b_ appears in SCOPe 2.02
  
• d1qz0b_ appears in SCOPe 2.04
  
• d1qz0b_ appears in the current release, SCOPe 2.08