Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species) |
Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries) |
Domain d1qz0b_: 1qz0 B: [96608] complexed with a phosphotyrosyl mimetic-containing hexapeptide, chains C, D, E and F complexed with fty; mutant |
PDB Entry: 1qz0 (more details), 1.5 Å
SCOP Domain Sequences for d1qz0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qz0b_ c.45.1.2 (B:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica} spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d1qz0b_: