| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
| Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species) |
| Species Yersinia enterocolitica [TaxId:630] [52812] (19 PDB entries) |
| Domain d1qz0a_: 1qz0 A: [96607] complexed with a phosphotyrosyl mimetic-containing hexapeptide, chains C, D, E and F |
PDB Entry: 1qz0 (more details), 1.5 Å
SCOPe Domain Sequences for d1qz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qz0a_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d1qz0a_: