Lineage for d1qz0a_ (1qz0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395648Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 395653Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)
  7. 395654Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries)
  8. 395656Domain d1qz0a_: 1qz0 A: [96607]

Details for d1qz0a_

PDB Entry: 1qz0 (more details), 1.5 Å

PDB Description: crystal structure of the yersinia pestis phosphatase yoph in complex with a phosphotyrosyl mimetic-containing hexapeptide

SCOP Domain Sequences for d1qz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz0a_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOP Domain Coordinates for d1qz0a_:

Click to download the PDB-style file with coordinates for d1qz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qz0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qz0b_