Lineage for d1qyyg_ (1qyy G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111716Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2111738Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 2111739Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2111748Domain d1qyyg_: 1qyy G: [96606]
    complexed with nag, pt

Details for d1qyyg_

PDB Entry: 1qyy (more details), 2.8 Å

PDB Description: crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution
PDB Compounds: (G:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d1qyyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyyg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql
nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcpt

SCOPe Domain Coordinates for d1qyyg_:

Click to download the PDB-style file with coordinates for d1qyyg_.
(The format of our PDB-style files is described here.)

Timeline for d1qyyg_: