SCOP 1.67: Domain d1qyyg_: 1qyy G:

Lineage for d1qyyg_ (1qyy G:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (2 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (8 PDB entries)

8. Domain d1qyyg_: 1qyy G: [96606]
   complexed with man, nag, pt; mutant

Details for d1qyyg_

PDB Entry: 1qyy, 2.8 Å

PDB Description: crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 2.8 angstrom resolution

SCOP Domain Sequences for d1qyyg_:

Sequence; same for both SEQRES and ATOM records:

>d1qyyg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql
nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcpt

Timeline for d1qyyg_:

• d1qyyg_ is new in SCOP 1.67
  
• d1qyyg_ appears in SCOP 1.69
  
• d1qyyg_ appears in the current release, SCOPe 2.08