Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) applies to all domains of a family if the common domain is composed of a different number of small repeating units this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries) |
Domain d1qyyg_: 1qyy G: [96606] complexed with nag, pt |
PDB Entry: 1qyy (more details), 2.8 Å
SCOPe Domain Sequences for d1qyyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qyyg_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} hpicevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltql nldraeltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt snvasvqcdnsdkfpvykypgkgcpt
Timeline for d1qyyg_: