Lineage for d1qysa_ (1qys A:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048404Fold k.41: New fold designs [103774] (1 superfamily)
  4. 3048405Superfamily k.41.1: New fold designs [103775] (1 family) (S)
  5. 3048406Family k.41.1.1: alpha+beta folds [103776] (1 protein)
  6. 3048407Protein Top7 [103777] (2 species)
    beta(2)-alpha-beta-alpha-beta(2); 2 layers: a/b; antiparallel beta-sheet: order 21354
  7. 3048408Species Synthetic, computationally designed sequence [103778] (1 PDB entry)
  8. 3048409Domain d1qysa_: 1qys A: [96603]

Details for d1qysa_

PDB Entry: 1qys (more details), 2.5 Å

PDB Description: Crystal structure of Top7: A computationally designed protein with a novel fold
PDB Compounds: (A:) top7

SCOPe Domain Sequences for d1qysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qysa_ k.41.1.1 (A:) Top7 {Synthetic, computationally designed sequence}
diqvqvniddngknfdytytvtteselqkvlnelmdyikkqgakrvrisitartkkeaek
faailikvfaelgyndinvtfdgdtvtvegql

SCOPe Domain Coordinates for d1qysa_:

Click to download the PDB-style file with coordinates for d1qysa_.
(The format of our PDB-style files is described here.)

Timeline for d1qysa_: