Lineage for d1qyoa1 (1qyo A:2-231)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2508399Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (202 PDB entries)
    Uniprot P42212
  8. 2508501Domain d1qyoa1: 1qyo A:2-231 [96601]
    Other proteins in same PDB: d1qyoa2

Details for d1qyoa1

PDB Entry: 1qyo (more details), 1.8 Å

PDB Description: Anaerobic precylization intermediate crystal structure for S65G Y66G GFP variant
PDB Compounds: (A:) green-fluorescent protein

SCOPe Domain Sequences for d1qyoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyoa1 d.22.1.1 (A:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgggvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d1qyoa1:

Click to download the PDB-style file with coordinates for d1qyoa1.
(The format of our PDB-style files is described here.)

Timeline for d1qyoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qyoa2